PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DS_E27ECBC6E.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 335aa    MW: 38459.8 Da    PI: 6.8568
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DS_E27ECBC6E.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.65.8e-1350861148
                           HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +lv++v+q+G + W+ Ia++++ gR +kqc++rw+++l
  Traes_7DS_E27ECBC6E.1 50 KLVKLVEQFGLRKWSQIAQMLP-GRVGKQCRERWHNHL 86
                           89********************.*************97 PP

2Myb_DNA-binding50.54.7e-1692134145
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            ++ W++eEd  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
  Traes_7DS_E27ECBC6E.1  92 KDTWSEEEDMVLIQTHKEVGNK-WAEIAKRLP-GRTENSIKNHWN 134
                            679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.8793986IPR017930Myb domain
PfamPF139211.3E-1549100No hitNo description
SMARTSM007173.3E-54988IPR001005SANT/Myb domain
CDDcd001673.12E-104986No hitNo description
Gene3DG3DSA:1.10.10.603.0E-244993IPR009057Homeodomain-like
SuperFamilySSF466893.4E-2866143IPR009057Homeodomain-like
PROSITE profilePS5129425.04187141IPR017930Myb domain
SMARTSM007172.5E-1591139IPR001005SANT/Myb domain
CDDcd001671.67E-1194137No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2194139IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MDAGRRQVRI RYVVSCLVQY FLCLQHCKSV LLLAILRWYQ EVRSCKFYRK LVKLVEQFGL  60
RKWSQIAQML PGRVGKQCRE RWHNHLRPNI KKDTWSEEED MVLIQTHKEV GNKWAEIAKR  120
LPGRTENSIK NHWNATKRRQ FARRRTRTSA KNPKSGTLLQ NYIKSLGIGS SKVTAAPLAP  180
KEPPLSPSSP APPTQNLAQV NDSWSESNPS STMITQGLFS TDDREADSWE EILVPTCDDF  240
SVDMCDGLFD TKEDAQYPVY SIDDDVDMDY IFNHMDYTIK IDHEIDMEMA WCDDALANIE  300
SGSSPLVTAV GPTEIKTVQV KEEMDLVELV TRTQT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-395014114105C-Myb DNA-Binding Domain
1mse_C3e-395014114105C-Myb DNA-Binding Domain
1gv2_A3e-395014114105MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-385014168159MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-385014168159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010228004.11e-139PREDICTED: transcription factor MYB46-like
TrEMBLW5IBL70.0W5IBL7_WHEAT; Uncharacterized protein
STRINGLOC_Os06g06740.11e-135(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28063788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.14e-53myb domain protein 98
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]